PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10000470
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 294aa    MW: 32667 Da    PI: 7.3822
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10000470genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.36.4e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT+eEd ll ++++ +G g W++ +++ g++R++k+c++rw++yl
      Lus10000470 14 RGAWTAEEDHLLTRYIESHGVGKWRSLPKKAGLNRCGKSCRLRWLNYL 61
                     89********************************************97 PP

2Myb_DNA-binding51.62.2e-1667111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg+ +++E++l+++++k+lG++ W++Ia +++ gRt++++k++w++ 
      Lus10000470  67 RGNISPDEEDLIIRLHKLLGNR-WSLIAGRLP-GRTDNEIKNYWNTN 111
                      7899******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.8961IPR017930Myb domain
SuperFamilySSF466892.88E-3011108IPR009057Homeodomain-like
SMARTSM007173.6E-131363IPR001005SANT/Myb domain
PfamPF002491.6E-151461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.6E-241568IPR009057Homeodomain-like
CDDcd001674.59E-101661No hitNo description
PROSITE profilePS5129424.46662116IPR017930Myb domain
SMARTSM007171.3E-1566114IPR001005SANT/Myb domain
PfamPF002497.2E-1567112IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.8E-2469115IPR009057Homeodomain-like
CDDcd001677.88E-1271112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 294 aa     Download sequence    Send to blast
MGRSPCCSKQ GMNRGAWTAE EDHLLTRYIE SHGVGKWRSL PKKAGLNRCG KSCRLRWLNY  60
LRPDIKRGNI SPDEEDLIIR LHKLLGNRWS LIAGRLPGRT DNEIKNYWNT NLGKRVLLEN  120
CFPISASSSS IRPTKPHSRK LMIFTSSNAQ LAATKKYSFI DQQVIKTKAL KCSSNQLLEY  180
QQQNLAEGKR INNIDTVLET SSSNELSCVD GTSSNSHTNN AVHEGSDELI MTMDFGGGAE  240
ISLSELLLGC EDLCDFNMIS SGKGTEPELL ISSEEMLDEG TWNNIDVIDQ KAA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-251211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
SwissprotP813934e-63MYB08_ANTMA; Myb-related protein 308
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G16720.11e-62myb domain protein 7